Recombinant Full Length Mouse Trace Amine-Associated Receptor 3(Taar3) Protein, His-Tagged
Cat.No. : | RFL384MF |
Product Overview : | Recombinant Full Length Mouse Trace amine-associated receptor 3(Taar3) Protein (Q5QD16) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-343) |
Form : | Lyophilized powder |
AA Sequence : | MDLIYIPEDLSSCPKFGNKSCPPTNRSFRVRMIMYLFMTGAMVITIFGNLVIIISISHFK QLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFGDSFCKFHASFDMMLSLTSIF HLCSIAIDRFYAVCDPLHYTTTMTVSMIKRLLAFCWAAPALFSFGLVLSEANVSGMQSYE ILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSRRHARALSDMPANTKG AVGKNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLDLLVWLGYF NSTCNPLIHGFFYPWFRKALQFIVSGKIFRSNSDTANLFPEAH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Taar3 |
Synonyms | Taar3; Trace amine-associated receptor 3; TaR-3; Trace amine receptor 3; mTaar3 |
UniProt ID | Q5QD16 |
◆ Recombinant Proteins | ||
TAS2R134-5954R | Recombinant Rat TAS2R134 Protein | +Inquiry |
NPPB-8050H | Synthetic Human Brain Natriuretic Peptide 32 | +Inquiry |
RFL31723CF | Recombinant Full Length Coxiella Burnetii Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged | +Inquiry |
SCO5315-938S | Recombinant Streptomyces coelicolor A3(2) SCO5315 protein, His-tagged | +Inquiry |
GPX4-23H | Recombinant Human GPX4 Protein | +Inquiry |
◆ Native Proteins | ||
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
IgG-328S | Native Swine Gamma Globulin Fraction | +Inquiry |
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR182-5791HCL | Recombinant Human GPR182 293 Cell Lysate | +Inquiry |
Pericardium-229R | Rhesus monkey Heart: Pericardium Lysate | +Inquiry |
FBXO36-605HCL | Recombinant Human FBXO36 cell lysate | +Inquiry |
IRAK3-5170HCL | Recombinant Human IRAK3 293 Cell Lysate | +Inquiry |
SMPD3-1651HCL | Recombinant Human SMPD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Taar3 Products
Required fields are marked with *
My Review for All Taar3 Products
Required fields are marked with *
0
Inquiry Basket