Recombinant Human SDC2 protein(61-140 aa), C-His-tagged

Cat.No. : SDC2-2728H
Product Overview : Recombinant Human SDC2 protein(P34741)(61-140 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 61-140 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLF
Gene Name SDC2 syndecan 2 [ Homo sapiens ]
Official Symbol SDC2
Synonyms SDC2; syndecan 2; heparan sulfate proteoglycan 1, cell surface associated , HSPG, HSPG1; syndecan-2; CD362; fibroglycan; SYND2; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated; HSPG; HSPG1;
Gene ID 6383
mRNA Refseq NM_002998
Protein Refseq NP_002989
MIM 142460
UniProt ID P34741

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SDC2 Products

Required fields are marked with *

My Review for All SDC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon