Recombinant Full Length Mouse Sterol O-Acyltransferase 1(Soat1) Protein, His-Tagged
Cat.No. : | RFL17435MF |
Product Overview : | Recombinant Full Length Mouse Sterol O-acyltransferase 1(Soat1) Protein (Q61263) (1-540aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-540) |
Form : | Lyophilized powder |
AA Sequence : | MSLRNRLSKSGENPEQDEAQKNFMDTYRNGHITMKQLIAKKRLLAAEAEELKPLFMKEVG CHFDDFVTNLIEKSASLDNGGCALTTFSILEEMKKNHRAKDLRAPPEQGKIFISRQSLLD ELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEGRLVLEFNLLAYAFGKFPTVIWTWWA MFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPP ASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPLPTVNQYLYFLFAPTLIYRD NYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSI LPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYY YVYKDLLWFFSKRFKSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIV NDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCRYVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Soat1 |
Synonyms | Soat1; Acact; Sterol O-acyltransferase 1; Acyl-coenzyme A:cholesterol acyltransferase 1; ACAT-1; Cholesterol acyltransferase 1 |
UniProt ID | Q61263 |
◆ Recombinant Proteins | ||
SOAT1-6662Z | Recombinant Zebrafish SOAT1 | +Inquiry |
SOAT1-698C | Recombinant Cynomolgus Monkey SOAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOAT1-15741M | Recombinant Mouse SOAT1 Protein | +Inquiry |
RFL22146CF | Recombinant Full Length Cricetulus Griseus Sterol O-Acyltransferase 1(Soat1) Protein, His-Tagged | +Inquiry |
RFL17435MF | Recombinant Full Length Mouse Sterol O-Acyltransferase 1(Soat1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOAT1-1665HCL | Recombinant Human SOAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Soat1 Products
Required fields are marked with *
My Review for All Soat1 Products
Required fields are marked with *
0
Inquiry Basket