Recombinant Full Length Mouse Retinoic Acid-Induced Protein 3(Gprc5A) Protein, His-Tagged

• Cat.No.: RFL27675MF
• Product Overview: Recombinant Full Length Mouse Retinoic acid-induced protein 3(Gprc5a) Protein (Q8BHL4) (1-356aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Mus musculus (Mouse)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-356)
• AA Sequence: MTTPTTAPSGCRSDLDSRYHRLCDLAEGWGIALETLAAVGAVATVACMFALVFLICKVQD SNKRKMLPAQFLFLLGVLGVFGLTFAFIIKLDGATGPTRFFLFGVLFAICFSCLLAHAFN LIKLVRGRKPLSWLVILSLAVGFSLVQDVIAIEYLVLTMNRTNVNVFSELPAPRRNEDFV MLLIYVLVLMVLTFFTSFLVFCGSFSGWKRHGFHICFTSFLSIAIWVAWIVLLLIPDIDR KWDDTILSTALVANGWVFLAFYILPEFRQLPRQRSPTDYPVEDAFCKPQLMKQSYGVENR AYSQEEITQGLEMGDTLYAPYSTHFQLQNHQKDFSIPRAQAPASPYNDYEGRKGDS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Gprc5a
• Synonyms: Gprc5a; Rai3; Raig1; Retinoic acid-induced protein 3; G-protein coupled receptor family C group 5 member A; Retinoic acid-induced gene 1 protein; RAIG-1
• UniProt ID: Q8BHL4