Recombinant Full Length Human GPRC5A Protein

Cat.No. : GPRC5A-5534HF
Product Overview : Human GPRC5A full-length ORF (NP_003970.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 370 amino acids
Description : This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq
Form : Liquid
Molecular Mass : 40.3 kDa
AA Sequence : MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GPRC5A G protein-coupled receptor, family C, group 5, member A [ Homo sapiens ]
Official Symbol GPRC5A
Synonyms GPRC5A; G protein-coupled receptor, family C, group 5, member A; GPCR5A, RAI3, retinoic acid induced 3; retinoic acid-induced protein 3; RAIG1; RAIG-1; retinoic acid induced 3; retinoic acid responsive; retinoic acid-induced gene 1 protein; orphan G-protein-coupling receptor PEIG-1; G-protein coupled receptor family C group 5 member A; RAI3; GPCR5A;
Gene ID 9052
mRNA Refseq NM_003979
Protein Refseq NP_003970
MIM 604138
UniProt ID Q8NFJ5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GPRC5A Products

Required fields are marked with *

My Review for All GPRC5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon