Recombinant Full Length Human GPRC5A Protein
Cat.No. : | GPRC5A-5534HF |
Product Overview : | Human GPRC5A full-length ORF (NP_003970.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 370 amino acids |
Description : | This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPRC5A G protein-coupled receptor, family C, group 5, member A [ Homo sapiens ] |
Official Symbol | GPRC5A |
Synonyms | GPRC5A; G protein-coupled receptor, family C, group 5, member A; GPCR5A, RAI3, retinoic acid induced 3; retinoic acid-induced protein 3; RAIG1; RAIG-1; retinoic acid induced 3; retinoic acid responsive; retinoic acid-induced gene 1 protein; orphan G-protein-coupling receptor PEIG-1; G-protein coupled receptor family C group 5 member A; RAI3; GPCR5A; |
Gene ID | 9052 |
mRNA Refseq | NM_003979 |
Protein Refseq | NP_003970 |
MIM | 604138 |
UniProt ID | Q8NFJ5 |
◆ Recombinant Proteins | ||
GPRC5A-2212H | Recombinant Human GPRC5A Protein, His-tagged | +Inquiry |
GPRC5A-5283H | Recombinant Human GPRC5A Protein | +Inquiry |
GPRC5A-1339H | Recombinant Human GPRC5A protein, GST-tagged | +Inquiry |
RFL27675MF | Recombinant Full Length Mouse Retinoic Acid-Induced Protein 3(Gprc5A) Protein, His-Tagged | +Inquiry |
RFL32696HF | Recombinant Full Length Human Retinoic Acid-Induced Protein 3(Gprc5A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRC5A-5771HCL | Recombinant Human GPRC5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPRC5A Products
Required fields are marked with *
My Review for All GPRC5A Products
Required fields are marked with *
0
Inquiry Basket