Recombinant Full Length Mouse Rapsn Protein, His-tagged

• Cat.No.: Rapsn-7312M
• Product Overview: Recombinant mouse RAPSN protein, fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Description: Postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 48.8 kDa
• Protein length: 1-412
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMGQDQTKQQIEKGLQLYQSNQTEKALQVWMKVLEKGSDLVGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARGLEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSLFQKALESFEKALRYAHNNDDTMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNDYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVHVLLGVAKCWMARKVQDKALDAIEKAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRTHVVRFHECVEETELYCGLCGESIGERNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
• Purity: > 85 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol 0.4M Urea

Gene Information

• Gene Name: Rapsn receptor-associated protein of the synapse [ Mus musculus (house mouse) ]
• Official Symbol: Rapsn
• Synonyms: Rapsn; receptor-associated protein of the synapse; r; Raps; 43kDa; Nraps; rapsyn; 43 kDa receptor-associated protein of the synapse; 43 kDa postsynaptic protein; 43kDa acetylcholine receptor-associated protein; acetylcholine receptor-associated 43 kDa protein; receptor-associated protein of the synapse, 43 kDa
• Gene ID: 19400
• mRNA Refseq: NM_009023
• Protein Refseq: NP_033049
• UniProt ID: P12672