Recombinant Full Length Mouse Proteinase-Activated Receptor 1(F2R) Protein, His-Tagged
Cat.No. : | RFL15007MF |
Product Overview : | Recombinant Full Length Mouse Proteinase-activated receptor 1(F2r) Protein (P30558) (42-430aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (42-430) |
Form : | Lyophilized powder |
AA Sequence : | SFFLRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYL TSPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLP FKISYYFSGTDWQFGSGMCRFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTL GRANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSA IFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVH YLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNS CNSTGQLMPSKMDTCSSHLNNSIYKKLLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F2r |
Synonyms | F2r; Cf2r; Par1; Proteinase-activated receptor 1; PAR-1; Thrombin receptor |
UniProt ID | P30558 |
◆ Recombinant Proteins | ||
F2R-3613H | Recombinant Human F2R Protein, GST-tagged | +Inquiry |
F2R-4158H | Recombinant Fluorescent Human F2R Full Length Transmembrane protein, GFP-tagged(VLPs) | +Inquiry |
F2R-375H | Recombinant Human F2R | +Inquiry |
RFL15007MF | Recombinant Full Length Mouse Proteinase-Activated Receptor 1(F2R) Protein, His-Tagged | +Inquiry |
F2R-367H | Recombinant Human F2R Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2R-27H | Native Human F2R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
F2R-2116HCL | Recombinant Human F2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F2r Products
Required fields are marked with *
My Review for All F2r Products
Required fields are marked with *
0
Inquiry Basket