Recombinant Human F2R Protein, GST-tagged

• Cat.No.: F2R-3613H
• Product Overview: Human F2R partial ORF ( NP_001983.1, 42 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 32.45 kDa
• AA Sequence: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: F2R coagulation factor II (thrombin) receptor [ Homo sapiens ]
• Official Symbol: F2R
• Synonyms: F2R; coagulation factor II (thrombin) receptor; proteinase-activated receptor 1; CF2R; PAR 1; PAR1; TR; thrombin receptor; protease-activated receptor 1; coagulation factor II receptor; HTR; PAR-1
• Gene ID: 2149
• mRNA Refseq: NM_001992
• Protein Refseq: NP_001983
• MIM: 187930
• UniProt ID: P25116