Recombinant Full Length Mouse Protein Fam189B(Fam189B) Protein, His-Tagged
Cat.No. : | RFL36668MF |
Product Overview : | Recombinant Full Length Mouse Protein FAM189B(Fam189b) Protein (Q5HZJ5) (1-669aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-669) |
Form : | Lyophilized powder |
AA Sequence : | MMPSPSDSSRSLTSRPSTRGLTHLRLHRPWLQALLTLGLAQVLLGILVITFSMVASSVTT TESIKRSCPSWAGFSLAFSGLVGIVSWKRPFTLVISFFSLLSVLCVMLSMAGSVLSCKNA QLARDFRECSMEGKVCVCCPPIPLHRPCPEWGQELKVALNSTCDEARGALKNLLFSVCGL TICAAIICTLSAIVCCVQIFSLDLVHMQLAPERSVSGPLGPLACTSSPPAPLLHTMLDLE EFVPPVPPPPYYPPEYTCSSETDAQSITYNGSMDSPVPLYPTDCPPSYEAVMGLRRDSQA TLFDPQLHDGSCVCERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSV DYVLFRSIQRSRAGYCLSLDCGLRGPFEDSPLPRRPPRAARSYSCSAPEAPPPLGAPTAA RSCHRLEGWPPWVGPCFPELRRRVPRGGSRSAAPPPARAPARRFSDSSGSLTPPGHRPPH RTPPPPLLLPRSHSDPGITTSSDIADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLAR CPSPKLLRARSAEKRRPVPTFQKVPLPSGPTPAHSLGDLKGSWPGRGLVTRFLQLSRRSP DPTGTGAHGYKQVRRSPWGRPGRESLHLRSCGDLSSGSSLRRLLSARRLEHGIRPHSLSL NGGSRETGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fam189b |
Synonyms | Fam189b; Protein FAM189B |
UniProt ID | Q5HZJ5 |
◆ Recombinant Proteins | ||
CA12-3407H | Recombinant Human CA12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD34-27867TH | Recombinant Human CD34 | +Inquiry |
RFL25626PF | Recombinant Full Length Prosthecochloris Aestuarii Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
SLAMF7-1223H | Recombinant Human SLAMF7 protein, His&Myc-tagged | +Inquiry |
SETBP1-6550H | Recombinant Human SETBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
Lectin-1825P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Fluorescein labeled | +Inquiry |
Chitin-001C | Native Crawfish Chitin | +Inquiry |
C1Q-20H | Active Native Human C1q Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKD1-8935HCL | Recombinant Human AKD1 293 Cell Lysate | +Inquiry |
RNPEP-1531HCL | Recombinant Human RNPEP cell lysate | +Inquiry |
SLC6A9-1702HCL | Recombinant Human SLC6A9 293 Cell Lysate | +Inquiry |
SNRPB2-1616HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
LYZ-4580HCL | Recombinant Human LYZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fam189b Products
Required fields are marked with *
My Review for All Fam189b Products
Required fields are marked with *
0
Inquiry Basket