Recombinant Full Length Mouse Prolactin-Releasing Peptide Receptor(Prlhr) Protein, His-Tagged
Cat.No. : | RFL34753MF |
Product Overview : | Recombinant Full Length Mouse Prolactin-releasing peptide receptor(Prlhr) Protein (Q6VMN6) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MTSLSTETTGDPDLSSGLLPASSTPANQSAEASEGNLSATVPRAAAVTPFQSLQLVHQLK GLIVMLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIALDRYVVLVHPLRRRISLRLSAYAV LGIWALSAVLALPAAVHTYHVELKPHDVSLCEEFWGSQERQRQIYAWGLLLGTYLLPLLA ILLSYVRVSVKLRNRVVPGSVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHIFNLL RDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKMLLSWPRKIVPH GQNMTVSVVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Prlhr |
Synonyms | Prlhr; Gm339; Gpr10; Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; G-protein coupled receptor 10 |
UniProt ID | Q6VMN6 |
◆ Recombinant Proteins | ||
PRLHR-4359R | Recombinant Rat PRLHR Protein, His (Fc)-Avi-tagged | +Inquiry |
PRLHR-7121M | Recombinant Mouse PRLHR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL34753MF | Recombinant Full Length Mouse Prolactin-Releasing Peptide Receptor(Prlhr) Protein, His-Tagged | +Inquiry |
PRLHR-4700R | Recombinant Rat PRLHR Protein | +Inquiry |
RFL13590BF | Recombinant Full Length Bovine Prolactin-Releasing Peptide Receptor(Prlhr) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prlhr Products
Required fields are marked with *
My Review for All Prlhr Products
Required fields are marked with *
0
Inquiry Basket