Recombinant Full Length Rat Prolactin-Releasing Peptide Receptor(Prlhr) Protein, His-Tagged
Cat.No. : | RFL25674RF |
Product Overview : | Recombinant Full Length Rat Prolactin-releasing peptide receptor(Prlhr) Protein (Q64121) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MTSLPPGTTGDPDLFSGPSPAGSTPANQSAEASESNVSATVPRAAAVTPFQSLQLVHQLK GLIVMLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLKLSAYAV LGIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQIYAWGLLLGTYLLPLLA ILLSYVRVSVKLRNRVVPGSVTQSQADWDRARRRRTFCLLVVVVVVFALCWLPLHIFNLL RDLDPRAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKMLLSWPRKIVPH GQNMTVSVVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Prlhr |
Synonyms | Prlhr; Gpr10; Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; G-protein coupled receptor 10; UHR-1 |
UniProt ID | Q64121 |
◆ Recombinant Proteins | ||
TAAR8B-16363M | Recombinant Mouse TAAR8B Protein | +Inquiry |
RFL17466OF | Recombinant Full Length Oryza Sativa Subsp. Indica Probable Xyloglucan Glycosyltransferase 2(Cslc2) Protein, His-Tagged | +Inquiry |
DLL1-218H | Active Recombinant Human DLL1, Fc-tagged | +Inquiry |
AT2G44140-5557A | Recombinant Mouse-ear cress ATG4A Protein (Lys2-Leu467), N-His tagged | +Inquiry |
B2M-011H | Recombinant Hamster beta 2 microglobulin Protein, His tagged | +Inquiry |
◆ Native Proteins | ||
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
ApoA4-68H | Native Human Apolipoprotein AIV | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPDA2-5842HCL | Recombinant Human GNPDA2 293 Cell Lysate | +Inquiry |
RABGGTA-2573HCL | Recombinant Human RABGGTA 293 Cell Lysate | +Inquiry |
GLIPR1-2392HCL | Recombinant Human GLIPR1 cell lysate | +Inquiry |
MRAP2-4214HCL | Recombinant Human MRAP2 293 Cell Lysate | +Inquiry |
SNRPD2-1614HCL | Recombinant Human SNRPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prlhr Products
Required fields are marked with *
My Review for All Prlhr Products
Required fields are marked with *
0
Inquiry Basket