Recombinant Full Length Mouse Potassium Voltage-Gated Channel Subfamily S Member 1(Kcns1) Protein, His-Tagged
Cat.No. : | RFL12772MF |
Product Overview : | Recombinant Full Length Mouse Potassium voltage-gated channel subfamily S member 1(Kcns1) Protein (O35173) (1-497aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-497) |
Form : | Lyophilized powder |
AA Sequence : | MVSEFPGPGSRVPWRPRDEALRVNVGGVRRLLSARALARFPGTRLGRLQAAASEEQARRL CDDYDAAAHEFYFDRHPGFFLGLLHFYRTGHLHVLDELCVFAFGQEADYWGLGENALATC CRARYLERRVARPRAWDEDSDAPSSVDPCPDEISDVQRELARYGAARCGRLRRRLWLTME NPGYSLPSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAAVAAVAAGRSAEEVRDDPV LRRLEYFCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVSVLPFYLTLLAGAALGDQRG ASGEELGDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGATLKHSYREVGILLLYLAVGVS VFSGVAYTAEEENEGFHTIPACWWWGTVSMTTVGYGDVVPETVGGKLAASGCILGGILVV ALPITIIFNKFSHFYRRQKALEAAVRSSGQREFEDLLSSVDGVSDVSLETSRDTSQEGRS TDLETQAPREPAKSHSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcns1 |
Synonyms | Kcns1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1 |
UniProt ID | O35173 |
◆ Recombinant Proteins | ||
MRPL3-5573H | Recombinant Human MRPL3 Protein, GST-tagged | +Inquiry |
RIN3-30673TH | Recombinant Human RIN3, His-tagged | +Inquiry |
LOX-89H | Active Recombinant Human LOX, His-tagged | +Inquiry |
S-160S | Recombinant SARS-CoV-2 (Lambda C.37 (Peru)) S1 (RBD) (L452Q, F490S) Protein (AA 319-541), C-GFP/His-Tagged (cleavable) | +Inquiry |
Sepw1-2584M | Recombinant Mouse Sepw1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
Streptolysin-171S | Native Streptolysin O protein | +Inquiry |
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Brain-48R | Rat Brain Membrane Lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
ALLC-63HCL | Recombinant Human ALLC cell lysate | +Inquiry |
COG6-7383HCL | Recombinant Human COG6 293 Cell Lysate | +Inquiry |
OSBPL1A-3539HCL | Recombinant Human OSBPL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Kcns1 Products
Required fields are marked with *
My Review for All Kcns1 Products
Required fields are marked with *
0
Inquiry Basket