Recombinant Full Length Chlorocebus Aethiops Potassium Voltage-Gated Channel Subfamily S Member 1(Kcns1) Protein, His-Tagged
Cat.No. : | RFL26401CF |
Product Overview : | Recombinant Full Length Chlorocebus aethiops Potassium voltage-gated channel subfamily S member 1(KCNS1) Protein (A4K2Y2) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorocebus Aethiops |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MLMLLVRGTHYESLRSKVVLPTPLGGRGTEALVSECPSPDTGIRWRQSDEALRVNVGGVR RLLSARALARFPGTRLGRLQAAASEEQARRLCDDYDAAAREFYFDRHPGFFLGLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLSQPRAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGTGGKELGHLGKVVQVFRLMRIFRVLKLAR HSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTV SMTTVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNS NHQEFEDLLSSVDGVSEASLETSRETSQEGRSADLETQAPSEPPHPQMY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNS1 |
Synonyms | KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1 |
UniProt ID | A4K2Y2 |
◆ Recombinant Proteins | ||
IL1B-1458C | Recombinant Cynomolgus IL1B protein, His-tagged | +Inquiry |
ANXA1-160HFL | Recombinant Full Length Human ANXA1 Protein, C-Flag-tagged | +Inquiry |
ERG-210H | Recombinant Human ERG protein, T7/His-tagged | +Inquiry |
Stac2-6156M | Recombinant Mouse Stac2 Protein, Myc/DDK-tagged | +Inquiry |
AMICA1-142R | Recombinant Rhesus Macaque AMICA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRE-8409HCL | Recombinant Human BRE 293 Cell Lysate | +Inquiry |
B3GALT1-8549HCL | Recombinant Human B3GALT1 293 Cell Lysate | +Inquiry |
COPZ1-7351HCL | Recombinant Human COPZ1 293 Cell Lysate | +Inquiry |
PEX26-3287HCL | Recombinant Human PEX26 293 Cell Lysate | +Inquiry |
Pancreas-360H | Human Pancreas Liver Cirrhosis Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNS1 Products
Required fields are marked with *
My Review for All KCNS1 Products
Required fields are marked with *
0
Inquiry Basket