Recombinant Full Length Pan Troglodytes Potassium Voltage-Gated Channel Subfamily S Member 1(Kcns1) Protein, His-Tagged
Cat.No. : | RFL36703PF |
Product Overview : | Recombinant Full Length Pan troglodytes Potassium voltage-gated channel subfamily S member 1(KCNS1) Protein (A4K2N8) (1-526aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-526) |
Form : | Lyophilized powder |
AA Sequence : | MLMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLSLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHR EFEDLLSSVDGVSEASLETSRETSQEGRSADLESQAPSEPPHPQMY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNS1 |
Synonyms | KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1 |
UniProt ID | A4K2N8 |
◆ Recombinant Proteins | ||
DHRS4-11976H | Recombinant Human DHRS4, GST-tagged | +Inquiry |
RFL26244AF | Recombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_2157 (Aq_2157) Protein, His-Tagged | +Inquiry |
ABCE1-245H | Recombinant Human ABCE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cx3cl1-225M | Active Recombinant Mouse Cx3cl1 | +Inquiry |
IL2-29H | Active Recombinant Human IL2 protein | +Inquiry |
◆ Native Proteins | ||
IgG-343M | Native MONKEY IgG | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
LTF-28999TH | Native Human LTF | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MERTK-413MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
TRIM43-774HCL | Recombinant Human TRIM43 293 Cell Lysate | +Inquiry |
IGIP-8007HCL | Recombinant Human C5orf53 293 Cell Lysate | +Inquiry |
Liver Cytoplasmic -139R | Rat Liver Cytoplasmic Lysate | +Inquiry |
KREMEN2-4883HCL | Recombinant Human KREMEN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCNS1 Products
Required fields are marked with *
My Review for All KCNS1 Products
Required fields are marked with *
0
Inquiry Basket