Recombinant Full Length Mouse Potassium Channel Subfamily K Member 9(Kcnk9) Protein, His-Tagged
Cat.No. : | RFL208MF |
Product Overview : | Recombinant Full Length Mouse Potassium channel subfamily K member 9(Kcnk9) Protein (Q3LS21) (1-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-402) |
Form : | Lyophilized powder |
AA Sequence : | MKRQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQ QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCLGAAAFSQ CEDWSFFHAYYYCFITLTTIGFGDFVALQAKGALQRKPFYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNTDEELLEGEVAEILAGNPRRVSVRAPQRRKRHHAMYFLRKYGRTLCYLCF PGTNWGKDDDDDDDDDVVDNVVVTAPISAPAPAPAPAPAPAAVAAGATIRSVRATVHTVS CRVEEIPPDVLRNTYFRSVFGAIPPGMHTCGDHRLHLRRKSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnk9 |
Synonyms | Kcnk9; Task3; Potassium channel subfamily K member 9; Acid-sensitive potassium channel protein TASK-3; TWIK-related acid-sensitive K(+ channel 3 |
UniProt ID | Q3LS21 |
◆ Recombinant Proteins | ||
SRM-30397TH | Recombinant Human SRM, His-tagged | +Inquiry |
AMH-2081B | Recombinant Bovine AMH Protein (25-575 aa), His-tagged | +Inquiry |
BCAS2-1849Z | Recombinant Zebrafish BCAS2 | +Inquiry |
RARB-1134H | Recombinant Human RARB, Ligand Binding Domain, GST-tagged | +Inquiry |
RHO-7583M | Recombinant Mouse RHO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
Lectin-1844S | Active Native Solanum Tuberosum Lectin Protein | +Inquiry |
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS27-4139HCL | Recombinant Human MRPS27 293 Cell Lysate | +Inquiry |
CDC2L2-7661HCL | Recombinant Human CDC2L2 293 Cell Lysate | +Inquiry |
NXPH3-3619HCL | Recombinant Human NXPH3 293 Cell Lysate | +Inquiry |
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
PTPLAD1-1435HCL | Recombinant Human PTPLAD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnk9 Products
Required fields are marked with *
My Review for All Kcnk9 Products
Required fields are marked with *
0
Inquiry Basket