Recombinant Full Length Mouse Polypeptide N-Acetylgalactosaminyltransferase 1(Galnt1) Protein, His-Tagged
Cat.No. : | RFL254MF |
Product Overview : | Recombinant Full Length Mouse Polypeptide N-acetylgalactosaminyltransferase 1(Galnt1) Protein (O08912) (1-559aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-559) |
Form : | Lyophilized powder |
AA Sequence : | MRKFAYCKVVLATSLVWVLLDMFLLLYFSECNKCEEKQERGLPAGDVLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNVTLPEIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Galnt1 |
Synonyms | Galnt1; Polypeptide N-acetylgalactosaminyltransferase 1; Polypeptide GalNAc transferase 1; GalNAc-T1; pp-GaNTase 1; Protein-UDP acetylgalactosaminyltransferase 1; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1 |
UniProt ID | O08912 |
◆ Recombinant Proteins | ||
GALNT1-1626R | Recombinant Rhesus Macaque GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT1-1253H | Recombinant Human GALNT1 Protein, MYC/DDK-tagged | +Inquiry |
RFL254MF | Recombinant Full Length Mouse Polypeptide N-Acetylgalactosaminyltransferase 1(Galnt1) Protein, His-Tagged | +Inquiry |
GALNT1-5142HF | Recombinant Full Length Human GALNT1 Protein, GST-tagged | +Inquiry |
GALNT1-2121R | Recombinant Rat GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Galnt1 Products
Required fields are marked with *
My Review for All Galnt1 Products
Required fields are marked with *
0
Inquiry Basket