Recombinant Full Length Mouse Nadph Oxidase 1(Nox1) Protein, His-Tagged
Cat.No. : | RFL32513MF |
Product Overview : | Recombinant Full Length Mouse NADPH oxidase 1(Nox1) Protein (Q8CIZ9) (1-591aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-591) |
Form : | Lyophilized powder |
AA Sequence : | MAGELRGSRGPLQRIQIAPREAPNLHLTMGNWLVNHWLSVLFLVSWLGLNIFLFVYAFLN YEKSDKYYYTREILGTALALARASALCLNFNSMMILIPVCRNLLSFLRGTCSFCNRTLRK PLDHNLTFHKLVAYMICIFTVIHIIAHLFNFERYRRSQQAMDGSLASVLSSLSHPEKEDS WLNPIQSPNMTVMYAAFTSIAGLTGVIATVALVLMVTSAMEFIRRNYFELFWYTHHLFIV YIICLGIHGLGGIVRGQTEESLGESHPHNCSHSFHEWDDHKGSCRHPHFAGHPPESWKWI LAPIAFYIFERILRFYRSQQKVVITKVVMHPSNVLELQMRKRGFSMEVGQYIFVNCPSIS FLEWHPFTLTSAPEEEFFSVHIRAAGDWTRNLIRTFEQQHSPMPRIEVDGPFGTVSEDVF QYEVAVLVGAGIGVTPFASILKSIWYKFQRADNKLKTQKIYFYWICRETGAFAWFNNLLN SLEQEMEELGKMDFLNYRLFLTGWDSNIAGHAALNFDRATDILTGLKQKTSFGRPMWDNE FSRIATAHPKSAVGVFLCGPRTLAKSLRKRCQRYSSLDPRKVQFYFNKETF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nox1 |
Synonyms | Nox1; NADPH oxidase 1; NOX-1 |
UniProt ID | Q8CIZ9 |
◆ Recombinant Proteins | ||
PRSS57-3929H | Recombinant Human PRSS57 Protein, His (Fc)-Avi-tagged | +Inquiry |
MICU3-3088H | Recombinant Human MICU3 Protein, GST-tagged | +Inquiry |
SCO3858-1179S | Recombinant Streptomyces coelicolor A3(2) SCO3858 protein, His-tagged | +Inquiry |
MYCBPAP-5830M | Recombinant Mouse MYCBPAP Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKN-3484H | Recombinant Human Parkin protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
hypogaea 2S-156A | Native Arachis hypogaea 2S protein | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Striatum-558M | MiniPig Striatum Lysate, Total Protein | +Inquiry |
IGHM-843HCL | Recombinant Human IGHM cell lysate | +Inquiry |
PRMT8-2837HCL | Recombinant Human PRMT8 293 Cell Lysate | +Inquiry |
TRIM52-769HCL | Recombinant Human TRIM52 293 Cell Lysate | +Inquiry |
TMEM161A-678HCL | Recombinant Human TMEM161A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nox1 Products
Required fields are marked with *
My Review for All Nox1 Products
Required fields are marked with *
0
Inquiry Basket