Recombinant Full Length Rat Nadph Oxidase 1(Nox1) Protein, His-Tagged
Cat.No. : | RFL7282RF |
Product Overview : | Recombinant Full Length Rat NADPH oxidase 1(Nox1) Protein (Q9WV87) (1-563aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-563) |
Form : | Lyophilized powder |
AA Sequence : | MGNWLVNHWLSVLFLVSWLGLNIFLFVYVFLNYEKSDKYYYTREILGTALALARASALCL NFNSMVILIPVCRNLLSFLRGTCSFCNHTLRKPLDHNLTFHKLVAYMICIFTAIHIIAHL FNFERYSRSQQAMDGSLASVLSSLFHPEKEDSWLNPIQSPNVTVMYAAFTSIAGLTGVVA TVALVLMVTSAMEFIRRNYFELFWYTHHLFIIYIICLGIHGLGGIVRGQTEESMSESHPR NCSYSFHEWDKYERSCRSPHFVGQPPESWKWILAPIAFYIFERILRFYRSRQKVVITKVV MHPCKVLELQMRKRGFTMGIGQYIFVNCPSISFLEWHPFTLTSAPEEEFFSIHIRAAGDW TENLIRTFEQQHSPMPRIEVDGPFGTVSEDVFQYEVAVLVGAGIGVTPFASFLKSIWYKF QRAHNKLKTQKIYFYWICRETGAFAWFNNLLNSLEQEMDELGKPDFLNYRLFLTGWDSNI AGHAALNFDRATDVLTGLKQKTSFGRPMWDNEFSRIATAHPKSVVGVFLCGPPTLAKSLR KCCRRYSSLDPRKVQFYFNKETF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nox1 |
Synonyms | Nox1; Mox1; Noh1; NADPH oxidase 1; NOX-1; Mitogenic oxidase 1; MOX-1; NADH/NADPH mitogenic oxidase subunit P65-MOX; NOH-1 |
UniProt ID | Q9WV87 |
◆ Recombinant Proteins | ||
FOLH1-2414H | Recombinant Human Folate Hydrolase, GST-tagged | +Inquiry |
CD70-515H | Recombinant Human CD70 Protein (Gln39-Pro193), N-mFc and C-6×His-tagged | +Inquiry |
ALOX15B-486H | Recombinant Human ALOX15B Protein, GST-tagged | +Inquiry |
ITGA11&ITGB1-0203C | Active Recombinant Canine ITGA11&ITGB1 protein, His-tagged | +Inquiry |
NETO1-743C | Recombinant Cynomolgus NETO1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGA-34D | Native Canine Fibrinogen | +Inquiry |
Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COQ3-7348HCL | Recombinant Human COQ3 293 Cell Lysate | +Inquiry |
DEPDC1-6974HCL | Recombinant Human DEPDC1 293 Cell Lysate | +Inquiry |
RBM12B-1482HCL | Recombinant Human RBM12B cell lysate | +Inquiry |
OIP5-3588HCL | Recombinant Human OIP5 293 Cell Lysate | +Inquiry |
PCDHGB2-3388HCL | Recombinant Human PCDHGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nox1 Products
Required fields are marked with *
My Review for All Nox1 Products
Required fields are marked with *
0
Inquiry Basket