Recombinant Full Length Mouse Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged
Cat.No. : | RFL36919MF |
Product Overview : | Recombinant Full Length Mouse Muscarinic acetylcholine receptor M3(Chrm3) Protein (Q9ERZ3) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQTSGNFSSNDTSSDPLG GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGTK RSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET RAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMDVERNAHKLQAQKSMDDRDNCQ KDFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFKEATLAKRFALKTRSQITKRKRM SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP VCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Chrm3 |
Synonyms | Chrm3; Chrm-3; Muscarinic acetylcholine receptor M3; Mm3 mAChR |
UniProt ID | Q9ERZ3 |
◆ Recombinant Proteins | ||
EPHB3-2871H | Recombinant Human EPHB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXB7-1590H | Recombinant Human HOXB7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL16209SF | Recombinant Full Length Atp Synthase Protein I(Atpi) Protein, His-Tagged | +Inquiry |
Pglyrp4-4823M | Recombinant Mouse Pglyrp4 Protein, Myc/DDK-tagged | +Inquiry |
RFL35460MF | Recombinant Full Length Mouse Upf0697 Protein C8Orf40 Homolog Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
B2M-13H | Native Human B2M | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
OMG-1924HCL | Recombinant Human OMG cell lysate | +Inquiry |
Breast-59H | Human Breast Tumor Lysate | +Inquiry |
DNASE1L2-229HCL | Recombinant Human DNASE1L2 lysate | +Inquiry |
DNM1L-6858HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
Lung-312H | Human Lung Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Chrm3 Products
Required fields are marked with *
My Review for All Chrm3 Products
Required fields are marked with *
0
Inquiry Basket