Recombinant Full Length Mouse Mucolipin-3(Mcoln3) Protein, His-Tagged
Cat.No. : | RFL28135MF |
Product Overview : | Recombinant Full Length Mouse Mucolipin-3(Mcoln3) Protein (Q8R4F0) (1-553aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-553) |
Form : | Lyophilized powder |
AA Sequence : | MANPEVLVSSCRARQDESPCTFHPSSSPSEQLLLEDQMRRKLKFFFMNPCEKFWARGRKP WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQS EVYDQIIFAVTQYLQLQNISVGNHAYENKGTKQSAMAICQHFYRQGTICPGNDTFDIDPE VETECFLVEPDEASHLGTPGENKLNLSLDFHRLLTVELQFKLKAINLQTVRHQELPDCYD FTLTITFDNKAHSGRIKISLDNDISIKECKDWHVSGSIQKNTHYMMIFDAFVILTCLASL VLCARSVIRGLQLQQEFVNFFLLHYKKEVSASDQMEFINGWYIMIIISDILTIVGSVLKM EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVMRFCCCAA MIYLGYCFCGWIVLGPYHEKFRSLNRVSECLFSLINGDDMFSTFAKMQQKSYLVWLFSRV YLYSFISLFIYMILSLFIALITDTYETIKHYQQDGFPETELRKFIAECKDLPNSGKYRLE DDPPGSLLCCCKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mcoln3 |
Synonyms | Mcoln3; Mucolipin-3; Transient receptor potential channel mucolipin 3; TRPML3 |
UniProt ID | Q8R4F0 |
◆ Recombinant Proteins | ||
PSME1-31227TH | Recombinant Human PSME1, His-tagged | +Inquiry |
ITPKC-5843HF | Recombinant Full Length Human ITPKC Protein, GST-tagged | +Inquiry |
SLC30A3-525H | Recombinant Human SLC30A3 Protein, His-tagged | +Inquiry |
KLF11-1559C | Recombinant Chicken KLF11 | +Inquiry |
NI36-RS07545-1206S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS07545 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
Lectin-1847S | Active Native Soybean Agglutinin Protein, Fluorescein labeled | +Inquiry |
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGD5-620HCL | Recombinant Human FGD5 cell lysate | +Inquiry |
Oak-699P | Oak Lysate, Total Protein | +Inquiry |
SH3BP5L-1869HCL | Recombinant Human SH3BP5L 293 Cell Lysate | +Inquiry |
CCDC65-7755HCL | Recombinant Human CCDC65 293 Cell Lysate | +Inquiry |
Skeletal Muscle-427R | Rabbit Skeletal Muscle Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Mcoln3 Products
Required fields are marked with *
My Review for All Mcoln3 Products
Required fields are marked with *
0
Inquiry Basket