Recombinant Full Length Mouse Melatonin Receptor Type 1B(Mtnr1B) Protein, His-Tagged
Cat.No. : | RFL34813MF |
Product Overview : | Recombinant Full Length Mouse Melatonin receptor type 1B(Mtnr1b) Protein (Q8CIQ6) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MPENSSIPNCCEASGLAARPSWSGSAGARPPVTARAPWVAPMLSTVVVVTTAVDFVGNLL VILSVLRNRKLRNAGNLFVVSLALADLVIALYPYPLILVAIIRDGWVLGEAHCKASAFVM GLSVIGSVFNITAIAINRYCCICHSTTYHRVCSHWYTPIYISLVWLLTLVALVPNFFVGS LEYDPRIYSCTFIQTASTQYTAAVVAIHFLLPMAVVSFCYLRIWVLVLQARRKAKATRKL RLRPSDLRSFLTMFAVFVVFAICWAPLNCIGLAVAINPEAMALQVPEGLFVTSYFLAYFN SCLNAIVYGLLNQNFRREYKRILLAIWNTRRCIQHASKHCLTEERQGPTPPAARATVPVK EGAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mtnr1b |
Synonyms | Mtnr1b; Melatonin receptor type 1B; Mel-1B-R; Mel1b receptor |
UniProt ID | Q8CIQ6 |
◆ Recombinant Proteins | ||
SCO0678-1466S | Recombinant Streptomyces coelicolor A3(2) SCO0678 protein, His-tagged | +Inquiry |
Car5a-768M | Recombinant Mouse Car5a Protein, MYC/DDK-tagged | +Inquiry |
Bmp1-4004M | Recombinant Mouse Bmp1 Protein (Glu615-Ser848), N-GST tagged | +Inquiry |
BCL2L2-10183H | Recombinant Human BCL2L2, His-tagged | +Inquiry |
TUBB6-2511Z | Recombinant Zebrafish TUBB6 | +Inquiry |
◆ Native Proteins | ||
APOC3-27333TH | Native Human APOC3 | +Inquiry |
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPZ1-1483HCL | Recombinant Human SPZ1 293 Cell Lysate | +Inquiry |
Heart-209P | Porcine Heart Lysate | +Inquiry |
OSTN-3519HCL | Recombinant Human OSTN 293 Cell Lysate | +Inquiry |
REG4-979HCL | Recombinant Human REG4 cell lysate | +Inquiry |
HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mtnr1b Products
Required fields are marked with *
My Review for All Mtnr1b Products
Required fields are marked with *
0
Inquiry Basket