Recombinant Full Length Mouse Melanin-Concentrating Hormone Receptor 1(Mchr1) Protein, His-Tagged
Cat.No. : | RFL24904MF |
Product Overview : | Recombinant Full Length Mouse Melanin-concentrating hormone receptor 1(Mchr1) Protein (Q8JZL2) (1-423aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-423) |
Form : | Lyophilized powder |
AA Sequence : | MSVGAGKEGVGRAVGLRGSRGCQAVEEDPFLDCGAQAPGQGGGGRWRLPQPAWVDGRALH SREQATCTGCMDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTI CLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWH FGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWAL SFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVK ILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFV YLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTES KGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mchr1 |
Synonyms | Mchr1; Gpr24; Slc1; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR; SLC-1; Somatostatin receptor-like protein |
UniProt ID | Q8JZL2 |
◆ Recombinant Proteins | ||
SMARCD1-9819Z | Recombinant Zebrafish SMARCD1 | +Inquiry |
RFL2785AF | Recombinant Full Length Arabidopsis Thaliana Protein Tic 20-I, Chloroplastic(Tic20-I) Protein, His-Tagged | +Inquiry |
EXO5-1119H | Recombinant Human EXO5 Protein (1-373 aa), His-SUMO-tagged | +Inquiry |
EIF4A3-2494H | Recombinant Human EIF4A3 Protein, GST-tagged | +Inquiry |
SYPL-16322M | Recombinant Mouse SYPL Protein | +Inquiry |
◆ Native Proteins | ||
URG-94H | Active Native Human Urokinase | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
Tf-392R | Native Rat Transferrin | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
VTN-5410H | Native Human Vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLA2-3054HCL | Recombinant Human POLA2 293 Cell Lysate | +Inquiry |
LGALS9-4761HCL | Recombinant Human LGALS9 293 Cell Lysate | +Inquiry |
ZNF503-2041HCL | Recombinant Human ZNF503 cell lysate | +Inquiry |
PPAN-2993HCL | Recombinant Human PPAN 293 Cell Lysate | +Inquiry |
XPOT-1939HCL | Recombinant Human XPOT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mchr1 Products
Required fields are marked with *
My Review for All Mchr1 Products
Required fields are marked with *
0
Inquiry Basket