Recombinant Full Length Mouse Leucine-Rich Repeat-Containing Protein 24(Lrrc24) Protein, His-Tagged
Cat.No. : | RFL23875MF |
Product Overview : | Recombinant Full Length Mouse Leucine-rich repeat-containing protein 24(Lrrc24) Protein (Q8BHA1) (24-521aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-521) |
Form : | Lyophilized powder |
AA Sequence : | LPPRATGCPAACRCYSATVECGALRLRVVPPGIPPGTQTLFLQDNSIAHLEQGSLAPLAA LRHLYLHNNTLRALESGAFRAQPRLLELALTGNRLRGLRGGAFVGLVQLRVLYLAGNQLA KLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISKEALQPLSS LQVLRLTENPWRCDCALHWLGSWIKEGGRRLLSSRDKKITCAEPPRLALQSLLEVSGGSL ICIPPSVNVEPPEFTANLGEDLQVACQASGYPQPLVVWRKVPQPRDGKPQAQAQLEGGAP GLGGHGTRDTGSGMLFLTNITLAHAGKYECEAANAGGKARVPFHLLVNASRQQSQQLPDP QAPATRPVGHEPQHEAGSMAFRALGLATQTAITAAIALLALTALLLAAMICRRRRRRKKV PAPSGEGTLFVNDYSDGPCTFAQLEELRDDHGHEMFVIDRSKPLFPEVLPEEAPEHNPPD GLKSGLRLPTRVAYEIHC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lrrc24 |
Synonyms | Lrrc24; Leucine-rich repeat-containing protein 24 |
UniProt ID | Q8BHA1 |
◆ Recombinant Proteins | ||
RFL21234CF | Recombinant Full Length Chlamydia Muridarum Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
ALOX12-10019Z | Recombinant Zebrafish ALOX12 | +Inquiry |
CCDC177-1332M | Recombinant Mouse CCDC177 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tars2-2112M | Recombinant Mouse Tars2 Protein, His-tagged | +Inquiry |
CCNB2-6835H | Recombinant Human Cyclin B2, His-tagged | +Inquiry |
◆ Native Proteins | ||
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGCG-1887HCL | Recombinant Human SGCG 293 Cell Lysate | +Inquiry |
LARP7-4821HCL | Recombinant Human LARP7 293 Cell Lysate | +Inquiry |
CHCHD6-7543HCL | Recombinant Human CHCHD6 293 Cell Lysate | +Inquiry |
HMBS-5483HCL | Recombinant Human HMBS 293 Cell Lysate | +Inquiry |
HCLS1-5611HCL | Recombinant Human HCLS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lrrc24 Products
Required fields are marked with *
My Review for All Lrrc24 Products
Required fields are marked with *
0
Inquiry Basket