Recombinant Full Length Mouse Glycerol-3-Phosphate Acyltransferase 4(Agpat6) Protein, His-Tagged
Cat.No. : | RFL31310MF |
Product Overview : | Recombinant Full Length Mouse Glycerol-3-phosphate acyltransferase 4(Agpat6) Protein (Q8K2C8) (38-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (38-456) |
Form : | Lyophilized powder |
AA Sequence : | VSFGIRKLYMKTLLKIFAWATLRMERGAKERNHQLYKPYTNGIIAKDPTSLEEEIKEIRR SGSSKALDKTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYIS LRLTILWGLGVLIRYCFLLPLRIALAFTGIGLLVVGTTMVGYLPNGRFKEFLSKHVHLMC YRICVRALTAIITYHNRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVI QRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKG SFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREKDE DAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpat4 |
Synonyms | Gpat4; Agpat6; Tsarg7; Glycerol-3-phosphate acyltransferase 4; GPAT4; 1-acylglycerol-3-phosphate O-acyltransferase 6; 1-AGP acyltransferase 6; 1-AGPAT 6; Acyl-CoA:glycerol-3-phosphate acyltransferase 4; Lysophosphatidic acid acyltransferase zeta; LPAAT-ze |
UniProt ID | Q8K2C8 |
◆ Recombinant Proteins | ||
MSLN-25C | Recombinant Cynomolgus MSLN Protein, Fc tagged | +Inquiry |
LONRF2-4348H | Recombinant Human LONRF2 Protein, GST-tagged | +Inquiry |
MOBKL1A-5453H | Recombinant Human MOBKL1A Protein, GST-tagged | +Inquiry |
DCTN6-1022R | Recombinant Rhesus Macaque DCTN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDH3A2-456M | Recombinant Mouse ALDH3A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
Fxa-281B | Active Native Bovine Factor Xa | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-262C | Cynomolgus monkey Kidney Lysate | +Inquiry |
TBCC-1218HCL | Recombinant Human TBCC 293 Cell Lysate | +Inquiry |
RGP1-541HCL | Recombinant Human RGP1 lysate | +Inquiry |
RAB7B-2582HCL | Recombinant Human RAB7B 293 Cell Lysate | +Inquiry |
TSPAN8-1064HCL | Recombinant Human TSPAN8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gpat4 Products
Required fields are marked with *
My Review for All Gpat4 Products
Required fields are marked with *
0
Inquiry Basket