Recombinant Human LONRF2 Protein, GST-tagged
| Cat.No. : | LONRF2-4348H |
| Product Overview : | Human FLJ45273 partial ORF ( NP_940863, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | LONRF2 (LON Peptidase N-Terminal Domain And Ring Finger 2) is a Protein Coding gene. GO annotations related to this gene include ATP-dependent peptidase activity. An important paralog of this gene is LONRF3. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 37.62 kDa |
| AA Sequence : | MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LONRF2 LON peptidase N-terminal domain and ring finger 2 [ Homo sapiens ] |
| Official Symbol | LONRF2 |
| Synonyms | LONRF2; LON peptidase N-terminal domain and ring finger 2; LON peptidase N-terminal domain and RING finger protein 2; FLJ45273; RNF192; RING finger protein 192; neuroblastoma apoptosis-related protease; MGC126711; MGC126713; |
| Gene ID | 164832 |
| mRNA Refseq | NM_198461 |
| Protein Refseq | NP_940863 |
| UniProt ID | Q1L5Z9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LONRF2 Products
Required fields are marked with *
My Review for All LONRF2 Products
Required fields are marked with *
0
Inquiry Basket
