Recombinant Full Length Mouse Gap Junction Gamma-2 Protein(Gjc2) Protein, His-Tagged
Cat.No. : | RFL1604MF |
Product Overview : | Recombinant Full Length Mouse Gap junction gamma-2 protein(Gjc2) Protein (Q8BQU6) (1-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-440) |
Form : | Lyophilized powder |
AA Sequence : | MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGESIYSDEQSKFTCNTRQ PGCDNVCYDAFAPLSHVRFWVFQIVVISTPSVMYLGYAVHRLARASEQERRRALRRRPGT RRLPRAQLPPPPPGWPDTTDLGEAEPILALEEDEDEEPGAPEGPGEDTEEERAEDVAAKG GGGDGKTVVTPGPAGQHDGRRRIQREGLMRVYVAQLVVRAAFEVAFLVGQYLLYGFEVPP FFACSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGSAQDAVRGR RGASAAGPGPTPRPPPCAFPAAAAGLACPPDYSLVVRAAERARAHDQNLANLALQALRDG AAVAAVSADRDSPPCAGLNATSRGAPRVGGLASGTGSATSGGTVGEQSRPGAQEQLATKP RAGSEKGSTGSRDGKATVWI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gjc2 |
Synonyms | Gjc2; Gja12; Gap junction gamma-2 protein; Connexin-47; Cx47; Gap junction alpha-12 protein |
UniProt ID | Q8BQU6 |
◆ Recombinant Proteins | ||
AGAP2-417H | Recombinant Human AGAP2 Protein, GST-tagged | +Inquiry |
MCPH1-5420M | Recombinant Mouse MCPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFOD1-1857H | Recombinant Human GFOD1 Protein, His-tagged | +Inquiry |
DLX3-123HF | Recombinant Full Length Human DLX3 Protein | +Inquiry |
RORC-5893H | Recombinant Human RORC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTGF-7205HCL | Recombinant Human CTGF 293 Cell Lysate | +Inquiry |
FCAR-3040HCL | Recombinant Human FCAR cell lysate | +Inquiry |
TAB1-1292HCL | Recombinant Human TAB1 293 Cell Lysate | +Inquiry |
IL29-5228HCL | Recombinant Human IL29 293 Cell Lysate | +Inquiry |
RFX2-2399HCL | Recombinant Human RFX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gjc2 Products
Required fields are marked with *
My Review for All Gjc2 Products
Required fields are marked with *
0
Inquiry Basket