Recombinant Full Length Mouse G-Protein Coupled Receptor 84(Gpr84) Protein, His-Tagged
Cat.No. : | RFL11861MF |
Product Overview : | Recombinant Full Length Mouse G-protein coupled receptor 84(Gpr84) Protein (Q8CIM5) (1-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-396) |
Form : | Lyophilized powder |
AA Sequence : | MWNSSDANFSCYHESVLGYRYFAVIWGVAVAVTGTVGNVLTLLALAIRPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGAVFCRIFGLLLFTSNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVFVLVPVVCTCSFDRMRGRPYTT ILMGIYFVLGLSSVGVFYCLIHRQVKRAARALDQYGLHQASIRSHQVAGTQEAMPGHFQE LDSGVASRGPSEGISSEPVSAATTQTLEGDSSEAGGQGIRKAAQQIAERSLPEVHRKPRE TAGARRATDAPSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARGRAPRVVHMVAANLTW LNSCINPVLYAAMNRQFRHAYGSILKRGPQSFRRFH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr84 |
Synonyms | Gpr84; G-protein coupled receptor 84 |
UniProt ID | Q8CIM5 |
◆ Recombinant Proteins | ||
CCDC89-117C | Recombinant Cynomolgus Monkey CCDC89 Protein, His (Fc)-Avi-tagged | +Inquiry |
RARS-4929R | Recombinant Rat RARS Protein | +Inquiry |
NNMT-1320H | Recombinant Human NNMT, GST-tagged | +Inquiry |
Ngf-810M | Active Recombinant Mouse Ngf protein | +Inquiry |
RHEB-6179H | Recombinant Full Length Human RHEB Protein (Met1-Met184), N-GST tagged | +Inquiry |
◆ Native Proteins | ||
IgG-343M | Native MONKEY IgG | +Inquiry |
LPA-8453H | Native Human LPA | +Inquiry |
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKT3-001MCL | Recombinant Mouse AKT3 cell lysate | +Inquiry |
HeLa-037HCL | Human Nocodazole Stimulated HeLa Cell Nuclear Extract | +Inquiry |
PDP2-3323HCL | Recombinant Human PDP2 293 Cell Lysate | +Inquiry |
LIG4-4746HCL | Recombinant Human LIG4 293 Cell Lysate | +Inquiry |
SLC1A6-600HCL | Recombinant Human SLC1A6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpr84 Products
Required fields are marked with *
My Review for All Gpr84 Products
Required fields are marked with *
0
Inquiry Basket