Recombinant Full Length Human G-Protein Coupled Receptor 84(Gpr84) Protein, His-Tagged
Cat.No. : | RFL24084HF |
Product Overview : | Recombinant Full Length Human G-protein coupled receptor 84(GPR84) Protein (Q9NQS5) (1-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-396) |
Form : | Lyophilized powder |
AA Sequence : | MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTT ILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQE LDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTW LNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR84 |
Synonyms | GPR84; EX33; G-protein coupled receptor 84; Inflammation-related G-protein coupled receptor EX33 |
UniProt ID | Q9NQS5 |
◆ Recombinant Proteins | ||
DNER-8380Z | Recombinant Zebrafish DNER | +Inquiry |
LCK-573H | Active Recombinant Human LCK, GST-tagged | +Inquiry |
SAP130-14666M | Recombinant Mouse SAP130 Protein | +Inquiry |
PPBP-04H | Recombinant Human chemokine (C-X-C Motif) Ligand 7 | +Inquiry |
RFL20748MF | Recombinant Full Length Mouse Sphingomyelin Phosphodiesterase 2(Smpd2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
LDH5-225H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM50B-945HCL | Recombinant Human TMEM50B 293 Cell Lysate | +Inquiry |
MAPK15-1058HCL | Recombinant Human MAPK15 cell lysate | +Inquiry |
SCRN3-2020HCL | Recombinant Human SCRN3 293 Cell Lysate | +Inquiry |
PTS-2668HCL | Recombinant Human PTS 293 Cell Lysate | +Inquiry |
MAU2-910HCL | Recombinant Human MAU2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR84 Products
Required fields are marked with *
My Review for All GPR84 Products
Required fields are marked with *
0
Inquiry Basket