Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase March4(41337) Protein, His-Tagged
Cat.No. : | RFL19248MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase MARCH4(41337) Protein (Q80TE3) (18-409aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-409) |
Form : | Lyophilized powder |
AA Sequence : | WYSCGLCTPAPQMLRHQGLLKCRCRMLFNDLKVFLLRRPPPAPLPMHGDPQLPGVAANNN TLPALGAGGWAGWRGPREAVGRETPPLPPPPPLPPSGDDDWDGPATGPPASLLSSASSDE FCKEKTEDCYSLGSSLDSGMRTPLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWIS ERGCWSCELCYYKYHVIAISTKNPLQWQAISLTVIEKVQIAAAILGSLFLIASISWLIWS TFSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYD KTKDLEDQKSGGRTNLQTSSSAQANLPSAEEEAASPPAREEGPTRAASHPSGPVSQHHCA YTILHILSHLRPHDQRSTQGSGRELVMRVTTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | March4 |
Synonyms | Marchf4; Kiaa1399; March4; E3 ubiquitin-protein ligase MARCHF4; Membrane-associated RING finger protein 4; Membrane-associated RING-CH protein IV; MARCH-IV; RING-type E3 ubiquitin transferase MARCHF4 |
UniProt ID | Q80TE3 |
◆ Recombinant Proteins | ||
RFL12166DF | Recombinant Full Length Dictyostelium Discoideum Putative Zdhhc-Type Palmitoyltransferase 2(Ddb_G0274739) Protein, His-Tagged | +Inquiry |
ALG11-9571H | Recombinant Human ALG11, His-tagged | +Inquiry |
NECTIN1-387H | Recombinant Human NECTIN1 Protein, His-tagged | +Inquiry |
FOXP3-1216H | Recombinant Human FOXP3 Protein, His-tagged | +Inquiry |
SPP1-5435H | Recombinant Human SPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
ATF-181R | Native Rat Apotransferrin | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK2-3371HCL | Recombinant Human PCSK2 293 Cell Lysate | +Inquiry |
STAM-636HCL | Recombinant Human STAM lysate | +Inquiry |
CPEB3-7315HCL | Recombinant Human CPEB3 293 Cell Lysate | +Inquiry |
Adrenal-736R | Rabbit Adrenal Lysate, Total Protein | +Inquiry |
Bladder-32H | Human Bladder Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All March4 Products
Required fields are marked with *
My Review for All March4 Products
Required fields are marked with *
0
Inquiry Basket