Recombinant Full Length Mouse Bcl-2-Like Protein 13(Bcl2L13) Protein, His-Tagged
Cat.No. : | RFL29571MF |
Product Overview : | Recombinant Full Length Mouse Bcl-2-like protein 13(Bcl2l13) Protein (P59017) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MASSTTASLGFHYETKYVVLSYLGLLSQEKQQGPSPPGVQLDVAPQSLNPEVLLKLKSEI EEELKTLDKEVSEAFTSTGFDCHTSPVFSPANPESSIEDCLAHLGERVSQDLKEPLQKAL QTILSQPVTYEAYRECTVETAVHASGWNKLLVPLVLLQHLLLELTRRGQEPLRMLLQFGV MYLEEHAAEFIIQQGGWGSVFSLEPEEEEYPGIIAEDSNDIYILPSDNSGQVSPPESPTV TTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSSGAGEKSENNSS NSDIVHVEKEEVPEEAFPGAAAPLLTQVPTVEAPEMMRAEKTSPTPSVFVELGEEELEAV TARPEAVERAEGAAQLSEERAGSRKKSHTGEAAAVRGAKSGLPAEGKAVLLFGGAAAVAI LAVAVGVALALRRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bcl2l13 |
Synonyms | Bcl2l13; Mil1; Bcl-2-like protein 13; Bcl2-L-13; Bcl-rambo; Protein Mil1 |
UniProt ID | P59017 |
◆ Recombinant Proteins | ||
RFL3111HF | Recombinant Full Length Human Bcl-2-Like Protein 13(Bcl2L13) Protein, His-Tagged | +Inquiry |
BCL2L13-3998Z | Recombinant Zebrafish BCL2L13 | +Inquiry |
BCL2L13-1600HF | Recombinant Full Length Human BCL2L13 Protein, GST-tagged | +Inquiry |
BCL2L13-154H | Recombinant Human BCL2L13 Protein, GST-tagged | +Inquiry |
BCL2L13-2346M | Recombinant Mouse BCL2L13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L13-61HCL | Recombinant Human BCL2L13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bcl2l13 Products
Required fields are marked with *
My Review for All Bcl2l13 Products
Required fields are marked with *
0
Inquiry Basket