Recombinant Full Length Mouse 3-Hydroxyacyl-Coa Dehydratase 3(Ptplad1) Protein, His-Tagged
Cat.No. : | RFL26852MF |
Product Overview : | Recombinant Full Length Mouse 3-hydroxyacyl-CoA dehydratase 3(ptplad1) Protein (Q8K2C9) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | METQVLTPHVYWAQRHRELYLRVELSDVQNPAISITDNVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPAYRLTQRQVNITVQKKGSHWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLEREGSPETLTNLKKGYLFMYNLVQLLGFSWIFVNLTVRFFILGKESF YDTFHNVADMMYFCQMLALVETLNAAIGVTSTPVLPALIQFLGRNFILFLVFGTMEEMQN KAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQS IPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKK LH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hacd3 |
Synonyms | Hacd3; Ptplad1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Butyrate-induced protein 1; B-ind1; Protein-tyrosine phosphatase-like A domain-containing protein 1 |
UniProt ID | Q8K2C9 |
◆ Recombinant Proteins | ||
ELL-2070C | Recombinant Chicken ELL | +Inquiry |
KDR-645HAF488 | Active Recombinant Human KDR Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
FST-27459TH | Recombinant Human FST, His-tagged | +Inquiry |
TSPAN2-5541H | Recombinant Human TSPAN2 protein, His-tagged | +Inquiry |
GLP2R-1613HF | Recombinant Full Length Human GLP2R Protein | +Inquiry |
◆ Native Proteins | ||
AFP-3017H | Native Human fetal cord serum | +Inquiry |
NADS-33 | Active Native NAD synthase | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAM2-1429HCL | Recombinant Human STAM2 293 Cell Lysate | +Inquiry |
SSFA2-1461HCL | Recombinant Human SSFA2 293 Cell Lysate | +Inquiry |
Vagina-563H | Human Vagina Membrane Lysate | +Inquiry |
MIS18BP1-202HCL | Recombinant Human MIS18BP1 cell lysate | +Inquiry |
OR10W1-457HCL | Recombinant Human OR10W1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Hacd3 Products
Required fields are marked with *
My Review for All Hacd3 Products
Required fields are marked with *
0
Inquiry Basket