Recombinant Full Length Mortierella Isabellina Delta(12) Fatty Acid Desaturase Protein, His-Tagged
Cat.No. : | RFL20368MF |
Product Overview : | Recombinant Full Length Mortierella isabellina Delta(12) fatty acid desaturase Protein (P59668) (1-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mortierella isabellina (Filamentous fungus) (Umbelopsis isabellina) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-400) |
Form : | Lyophilized powder |
AA Sequence : | MAPPNTIDAGLTQRHITTTAAPTSAKPAFERNYQLPEFTIKEIRECIPAHCFERSGLRGL CHVAIDLTWASLLFLAATQIDKFENPLIRYLAWPAYWIMQGIVCTGIWVLAHECGHQSFS TSKTLNNTVGWILHSMLLVPYHSWRISHSKHHKATGHMTKDQVFVPKTRSQVGLPPKESA AAAVQEEDMSVHLDEEAPIVTLFWMVIQFLFGWPAYLIMNASGQDYGRWTSHFHTYSPIF EPRNFFDIIISDLGVLAALGALIYASMQLSLLTVTKYYIIPYLFVNFWLVLITFLQHTDP KLPHYREGAWNFQRGALCTVDRSFGKFLDHMFHGIVHTHVAHHLFSQMPFYHAEEATYHL KKLLGEYYVYDPSPIVVAVWRSFRECRFVEDHGDVVFFKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mortierella isabellina Delta(12) fatty acid desaturase |
Synonyms | Delta(12 fatty acid desaturase; Delta-12 fatty acid desaturase |
UniProt ID | P59668 |
◆ Recombinant Proteins | ||
Sfrp2-223M | Active Recombinant Mouse Sfrp2, His-tagged | +Inquiry |
MAFF-8852H | Recombinant Human MAFF protein, His-tagged | +Inquiry |
MATN3-939H | Active Recombinant Human MATN3 Protein, His-tagged | +Inquiry |
ATG10-2073M | Recombinant Mouse ATG10 Protein | +Inquiry |
MERTK-30094TH | Recombinant Human MERTK | +Inquiry |
◆ Native Proteins | ||
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
HDL-1539H | Native Human High-density lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRN3-504HCL | Recombinant Human LRRN3 cell lysate | +Inquiry |
TRAPPC3-807HCL | Recombinant Human TRAPPC3 293 Cell Lysate | +Inquiry |
CD40LG-1205RCL | Recombinant Rat CD40LG cell lysate | +Inquiry |
ZNF180-132HCL | Recombinant Human ZNF180 293 Cell Lysate | +Inquiry |
ATF5-8629HCL | Recombinant Human ATF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mortierella isabellina Delta(12) fatty acid desaturase Products
Required fields are marked with *
My Review for All Mortierella isabellina Delta(12) fatty acid desaturase Products
Required fields are marked with *
0
Inquiry Basket