Recombinant Full Length Mortierella Alpina Palmitoyltransferase Akr1 Protein, His-Tagged
Cat.No. : | RFL29120MF |
Product Overview : | Recombinant Full Length Mortierella alpina Palmitoyltransferase AKR1 Protein (Q9UVH3) (1-559aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mortierella alpina (Oleaginous fungus) (Mortierella renispora) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-559) |
Form : | Lyophilized powder |
AA Sequence : | DPMLQDSQGFNALHLATHSSNAMLVLYLLMAGEMPVDTADTLGHTSLMWAAYQGDSLSVQ ILLKHGARVDTKDREGFTPLHWAVVKGNRECLSKILMAGADIKAGDKSGKTPVDMIKELK GTMIWDKALSDAKLSSDGQTRRTPFDKLMVLFPWYIALPLAVAQFLFGHIGAIKFLLRTR TPNDMLQTPYYTAVFQSTAFWVGFVWLRYLLGNTSHLLWMNIAFFVGYTSALYFFYGAVM ADPGWTKANSSYESQREAVVQMADRGLLDARHFCVSCIAQRPLRSKHCKFCNRCVAKFDH HCPWIYNCIGAKNHRAFLIFLALFLSSVPIYAYLSFEYLHVLSPSYVPVSSDPCLLGDTL CGYFQYDAFTTTLAFWSLFQMTWPGLLFLVQLYQVGQAKTTNEAMNFQRHSYLGKSMTIR QRILRSLTEIDSEMAGAGHPLQEESINLLEANGTATNDEDEVTLFAQEESKPVGFGDHEG HNHGARRAGGGGMWNLLVGTARRRRQQGEDRDVNPFDFGLWQNCVGFWSDGTQGPMRGVN WYSFYEAEARGGAATSRRM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mortierella alpina Palmitoyltransferase AKR1 |
Synonyms | Palmitoyltransferase AKR1; Ankyrin repeat-containing protein AKR1; Fragment |
UniProt ID | Q9UVH3 |
◆ Recombinant Proteins | ||
RFL13095SF | Recombinant Full Length Staphylococcus Epidermidis Na(+)/H(+) Antiporter Subunit E1(Mnhe1) Protein, His-Tagged | +Inquiry |
NPM3-1418H | Recombinant Human Nucleophosmin/nucleoplasmin 3, GST-tagged | +Inquiry |
ADAMTS2-304H | Recombinant Human ADAMTS2 Protein, GST-tagged | +Inquiry |
USP40-9966M | Recombinant Mouse USP40 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRTOMT-2396R | Recombinant Rhesus Macaque LRTOMT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS16-2171HCL | Recombinant Human RPS16 293 Cell Lysate | +Inquiry |
Stomach-Cardia-493H | Human Stomach-Cardia Membrane Lysate | +Inquiry |
LYPLAL1-4587HCL | Recombinant Human LYPLAL1 293 Cell Lysate | +Inquiry |
CAPN2-7863HCL | Recombinant Human CAPN2 293 Cell Lysate | +Inquiry |
LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mortierella alpina Palmitoyltransferase AKR1 Products
Required fields are marked with *
My Review for All Mortierella alpina Palmitoyltransferase AKR1 Products
Required fields are marked with *
0
Inquiry Basket