Recombinant Full Length Staphylococcus Epidermidis Na(+)/H(+) Antiporter Subunit E1(Mnhe1) Protein, His-Tagged
Cat.No. : | RFL13095SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Na(+)/H(+) antiporter subunit E1(mnhE1) Protein (Q8CPV2) (1-159aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-159) |
Form : | Lyophilized powder |
AA Sequence : | MAIQFVINLLVSVIWLLVTNSYTLNNFVLGFILGLFLVYLLHRVLPGQFYLVRIYRIIML IITFLTELIKANFGVLKIILKPRIENKPGFFVYETELERDWQLVLLSNLITLTPGTVVLG ISDDRKKIYIHSIDFSTKEEEIQNIKSSLEKVVRKVGEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mnhE1 |
Synonyms | mnhE1; SE_0642; Na(+/H(+ antiporter subunit E1; Mnh complex subunit E1 |
UniProt ID | Q8CPV2 |
◆ Native Proteins | ||
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
Collagen Type I-10G | Native Goat Collagen Type I Protein | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
Fixa-280B | Active Native Bovine Factor IXa - DEGR | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM82-1796HCL | Recombinant Human TMEM82 cell lysate | +Inquiry |
Brain-84M | Mouse Brain Tissue Lysate (7 Days Old) | +Inquiry |
FLT4-2016MCL | Recombinant Mouse FLT4 cell lysate | +Inquiry |
REG1A-988CCL | Recombinant Cynomolgus REG1A cell lysate | +Inquiry |
CKLF-7485HCL | Recombinant Human CKLF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mnhE1 Products
Required fields are marked with *
My Review for All mnhE1 Products
Required fields are marked with *
0
Inquiry Basket