Recombinant Full Length Microcystis Aeruginosa Photosystem I Reaction Center Subunit Xi(Psal) Protein, His-Tagged
Cat.No. : | RFL36772MF |
Product Overview : | Recombinant Full Length Microcystis aeruginosa Photosystem I reaction center subunit XI(psaL) Protein (B0JT88) (1-160aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Microcystis aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-160) |
Form : | Lyophilized powder |
AA Sequence : | MAETGYKQVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHG YFLGGPWVVLGPLRDSEYANIGGLIPALAMVLLATGCLASYGLVSFQGKAASNDPLKSAE GWSQFAAGFFIGGMGGAFVAYFLLENLGVVDGIMRGVFNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psaL |
Synonyms | psaL; MAE_43690; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L |
UniProt ID | B0JT88 |
◆ Recombinant Proteins | ||
CHGB-2056H | Recombinant Human Chromogranin B (Secretogranin 1), His-tagged | +Inquiry |
GATA3-8812Z | Recombinant Zebrafish GATA3 | +Inquiry |
CARHSP1-796R | Recombinant Rat CARHSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
hly-453S | Recombinant Staphylococcus aureus hly protein, N/A-tagged | +Inquiry |
SLC9A8-8434M | Recombinant Mouse SLC9A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MB-30275TH | Native Human MB | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFP37-179HCL | Recombinant Human ZFP37 293 Cell Lysate | +Inquiry |
PHF21A-3230HCL | Recombinant Human PHF21A 293 Cell Lysate | +Inquiry |
SH3GL1-1868HCL | Recombinant Human SH3GL1 293 Cell Lysate | +Inquiry |
MOCS2-4261HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
C1orf115-8185HCL | Recombinant Human C1orf115 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psaL Products
Required fields are marked with *
My Review for All psaL Products
Required fields are marked with *
0
Inquiry Basket