Recombinant Full Length Cyanothece Sp. Photosystem I Reaction Center Subunit Xi(Psal) Protein, His-Tagged
Cat.No. : | RFL4847CF |
Product Overview : | Recombinant Full Length Cyanothece sp. Photosystem I reaction center subunit XI(psaL) Protein (B1WPZ7) (1-156aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanothece sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-156) |
Form : | Lyophilized powder |
AA Sequence : | MDIIGQRGDPQIGNLATPVNSSRLSLAFIRNLPAYRRGLSANRRGLEVGMAHGYFLYGPF AILGPLRNTEYASTGGLLSAVAMISILTIALSLYASVEVGKPIETLTTPDVPEDLGTSVG WGEFANGFFIGGSGGVIFAYLLCQALYFDLIQKILG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psaL |
Synonyms | psaL; cce_3964; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L |
UniProt ID | B1WPZ7 |
◆ Recombinant Proteins | ||
ANKRD46-46C | Recombinant Cynomolgus Monkey ANKRD46 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCRL3-12830H | Recombinant Human FCRL3, His-tagged | +Inquiry |
MHC2DBB-4601Z | Recombinant Zebrafish MHC2DBB | +Inquiry |
CKAP2L-3491M | Recombinant Mouse CKAP2L Protein | +Inquiry |
Putative read through protein P5-5843P | Recombinant PeVYV Putative read through Protein P5 (Val207-Gly437), N-His and N-SUMO tagged | +Inquiry |
◆ Native Proteins | ||
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRI1-4202HCL | Recombinant Human MRI1 293 Cell Lysate | +Inquiry |
TMEM231-960HCL | Recombinant Human TMEM231 293 Cell Lysate | +Inquiry |
KRBA2-997HCL | Recombinant Human KRBA2 cell lysate | +Inquiry |
SPG21-454MCL | Recombinant Mouse SPG21 cell lysate | +Inquiry |
VPS45-384HCL | Recombinant Human VPS45 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psaL Products
Required fields are marked with *
My Review for All psaL Products
Required fields are marked with *
0
Inquiry Basket