Recombinant Full Length Methanothermobacter Thermautotrophicus Uncharacterized Protein Mth_518 (Mth_518) Protein, His-Tagged
Cat.No. : | RFL4221MF |
Product Overview : | Recombinant Full Length Methanothermobacter thermautotrophicus Uncharacterized protein MTH_518 (MTH_518) Protein (O26618) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanothermobacter thermautotrophicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MVCMRFRYICHRKPERTFSFRGHYFPVCSRCTGIYLGAFTYFLYAFLIPVKYTAATVLLA LLLVIPTFIDGFTQLMGYRESNNVLRFSTGLPAGIGLAVLTKVLKHLILHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTH_518 |
Synonyms | MTH_518; Uncharacterized protein MTH_518 |
UniProt ID | O26618 |
◆ Recombinant Proteins | ||
HIGD1A-2843R | Recombinant Rat HIGD1A Protein | +Inquiry |
RFL12343HF | Recombinant Full Length Hylobates Lar Atp Synthase Subunit A(Mt-Atp6) Protein, His-Tagged | +Inquiry |
ARL3-4013Z | Recombinant Zebrafish ARL3 | +Inquiry |
ADAM30-287H | Recombinant Human ADAM30 Protein, GST-tagged | +Inquiry |
CD276-1235CAF488 | Recombinant Monkey CD276 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
UO-44 | Active Native Urate oxidase | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
Ovary-025H | Human Ovary Lysate, Total Protein | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MME-001CCL | Recombinant Cynomolgus MME cell lysate | +Inquiry |
ZNF791-2090HCL | Recombinant Human ZNF791 cell lysate | +Inquiry |
DNAJC24-6874HCL | Recombinant Human DNAJC24 293 Cell Lysate | +Inquiry |
CPB-135R | Rabbit Anti-RSVgp07 Polyclonal Antibody | +Inquiry |
MOCS2-4261HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTH_518 Products
Required fields are marked with *
My Review for All MTH_518 Products
Required fields are marked with *
0
Inquiry Basket