Recombinant Human ADAM30 Protein, GST-tagged

Cat.No. : ADAM30-287H
Product Overview : Human ADAM30 partial ORF ( NP_068566, 199 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAM30 ADAM metallopeptidase domain 30 [ Homo sapiens ]
Official Symbol ADAM30
Synonyms ADAM30; ADAM metallopeptidase domain 30; a disintegrin and metalloproteinase domain 30; disintegrin and metalloproteinase domain-containing protein 30; svph4;
Gene ID 11085
mRNA Refseq NM_021794
Protein Refseq NP_068566
MIM 604779
UniProt ID Q9UKF2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADAM30 Products

Required fields are marked with *

My Review for All ADAM30 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon