Recombinant Full Length Methanocaldococcus Jannaschii Upf0132 Membrane Protein Mj1527(Mj1527) Protein, His-Tagged
Cat.No. : | RFL21517MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii UPF0132 membrane protein MJ1527(MJ1527) Protein (Q58922) (1-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-140) |
Form : | Lyophilized powder |
AA Sequence : | MNIYLISKVFIKYHLFQNILKSYLLNFLVRLMALGLDRNMEGVLCYLLFWISGLIFLLLE REDDFIRFHAMQSFITFLSLNLIAIIVSAIPIIGWVASTLINIAIIILWIVGMIKAYNGE RYKFPVFGDIAERYYREFLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1527 |
Synonyms | MJ1527; UPF0132 membrane protein MJ1527 |
UniProt ID | Q58922 |
◆ Native Proteins | ||
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
IgA-249P | Native Pig Immunoglobulin A | +Inquiry |
F2-275B | Active Native Bovine α-Thrombin-DFP | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSFM-720HCL | Recombinant Human TSFM 293 Cell Lysate | +Inquiry |
TRIM58-766HCL | Recombinant Human TRIM58 293 Cell Lysate | +Inquiry |
NDRG2-3930HCL | Recombinant Human NDRG2 293 Cell Lysate | +Inquiry |
ASB13-8666HCL | Recombinant Human ASB13 293 Cell Lysate | +Inquiry |
ACTR3B-9048HCL | Recombinant Human ACTR3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ1527 Products
Required fields are marked with *
My Review for All MJ1527 Products
Required fields are marked with *
0
Inquiry Basket