Recombinant Human MOG protein, GST-tagged
Cat.No. : | MOG-301349H |
Product Overview : | Recombinant Human MOG (30-154 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly30-Gly154 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MOG myelin oligodendrocyte glycoprotein [ Homo sapiens ] |
Official Symbol | MOG |
Synonyms | MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5; MOGIG2; NRCLP7; MGC26137; |
Gene ID | 4340 |
mRNA Refseq | NM_001008228 |
Protein Refseq | NP_001008229 |
MIM | 159465 |
UniProt ID | Q16653 |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOG Products
Required fields are marked with *
My Review for All MOG Products
Required fields are marked with *
0
Inquiry Basket