Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1561(Mj1561) Protein, His-Tagged
Cat.No. : | RFL6380MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ1561(MJ1561) Protein (Q58956) (1-553aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-553) |
Form : | Lyophilized powder |
AA Sequence : | MITNKIKIFLISLIFISGVYALQVDAPQYQPNVIHPGDDVDLWIKITNDNYDNEVKNIVV EVSPHYPFELRQVNPIKGKATISHLNPGESDTVYFKLHVDENAPSRDYEIDVKVSYDEIN KEDGKETIHHYEITKIYYLHVYGIASFEINGNFSLIPSKTQTVPIEIINTGTGTAKEVNL YIGYSLNSVNAGSESVEVSAYGTTKTQEKTIYYPTAVPISNLPISPVGETKFYLGALKPD NSRVINLKLYTASNLVEGCYQIPAVITWIDEDGTKRAEQITIGAYVKGDILLGISNVVTD PKEIKPGTTYVRIDVTITNNGHAEAKDVKLKLITNKPFKDSWSNCNIKDVGNLLPGVSKT VSFYVDVDKYASAKHYKLPIEISYLDTANNKYKTEKFIDIYVKPKPLFEIITKEVNVTAG KENTVYITIKNVGSEKAERVKISAIRNSGQPFDYPIKSDTIGTLYPNQTGTGVIVIDVDK NAESKPYIITIEIRCAGDSDEGDNNVYVYQEPLKVVVNNSNSKSYWILGIIVVIAIVLVV GYVFKRKNSKDKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ1561 |
Synonyms | MJ1561; Uncharacterized protein MJ1561 |
UniProt ID | Q58956 |
◆ Recombinant Proteins | ||
MAPKAPK2-9544M | Recombinant Mouse MAPKAPK2 Protein | +Inquiry |
RFL18783YF | Recombinant Full Length Yersinia Enterocolitica Subsp. Palearctica Serotype O:3 L-Alanine Exporter Alae(Alae) Protein, His-Tagged | +Inquiry |
IGBP1-12681Z | Recombinant Zebrafish IGBP1 | +Inquiry |
Cr2-2729M | Recombinant Mouse Cr2 protein, His-tagged | +Inquiry |
SLAMF8-5027H | Recombinant Human SLAMF8 Protein (Met1-Asp233), C-His tagged | +Inquiry |
◆ Native Proteins | ||
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
FTL-26944TH | Native Human FTL | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
C-type lectin like protein-040H | Native Hen C-type lectin like protein Protein | +Inquiry |
Clostripain-02C | Native Clostridium histolyticum Clostripain, Sequencing Grade | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM15-1483HCL | Recombinant Human RBM15 cell lysate | +Inquiry |
TLR10-1046HCL | Recombinant Human TLR10 293 Cell Lysate | +Inquiry |
LACE1-4832HCL | Recombinant Human LACE1 293 Cell Lysate | +Inquiry |
ABR-9122HCL | Recombinant Human ABR 293 Cell Lysate | +Inquiry |
THY1-2384MCL | Recombinant Mouse THY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ1561 Products
Required fields are marked with *
My Review for All MJ1561 Products
Required fields are marked with *
0
Inquiry Basket