Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0518(Mj0518) Protein, His-Tagged
Cat.No. : | RFL29180MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Uncharacterized protein MJ0518(MJ0518) Protein (Q57938) (1-94aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-94) |
Form : | Lyophilized powder |
AA Sequence : | MGLFELNLAIILFIIGNFIGLEYSYRKYSSPYVEKGIDKFALAISVFGGILINSPLYMLG CLLIGFPLGMRPGYGRVEFVVGLAVALFLYFLRW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0518 |
Synonyms | MJ0518; Uncharacterized protein MJ0518 |
UniProt ID | Q57938 |
◆ Recombinant Proteins | ||
CDC73-597R | Recombinant Rhesus Macaque CDC73 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL4-102H | Recombinant Human ANGPTL4 Protein, FLAG-tagged | +Inquiry |
arfA-5674M | Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) arfA protein, His-tagged | +Inquiry |
RPL18-14413M | Recombinant Mouse RPL18 Protein | +Inquiry |
EPOR-2045H | Recombinant Human EPOR Protein, Fc/His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
IgG-353C | Native Chicken IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
ENPEP-405MCL | Recombinant Mouse ENPEP cell lysate | +Inquiry |
PSMA8-1429HCL | Recombinant Human PSMA8 cell lysate | +Inquiry |
TRAF7-816HCL | Recombinant Human TRAF7 293 Cell Lysate | +Inquiry |
RBMS1-2462HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0518 Products
Required fields are marked with *
My Review for All MJ0518 Products
Required fields are marked with *
0
Inquiry Basket