Recombinant Full Length Methanocaldococcus Jannaschii Small-Conductance Mechanosensitive Channel Mscmj(Mj0170) Protein, His-Tagged
Cat.No. : | RFL6313MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Small-conductance mechanosensitive channel MscMJ(MJ0170) Protein (Q57634) (1-350aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-350) |
Form : | Lyophilized powder |
AA Sequence : | MNMEIFGNSISNILIFVVITLLGIFIGKIVDKIVRNYLKKIIDKTKTKFDDIILESIDLP IIVLVVTLFFYFGLRFLILPDYILKLIDEAVKVVVILSATYFAVKFIDGIFEHYLIPLTE KTETELDEHIIKPLKKVVKILTILLGILTALSSVGYDITALLAGLGVGGLALALAMQDTI KNFIAGILILIDKPFSLGHWVKVKGAEGIVEEIGIRSTRIRTFDYTLITIPNSELLDSAI ENLTVRDRRRVLMTIGLTYNTPVEKIKRAKEIIKEIVENHPATLPPYRVHFREYGDWSLN LRVEYFVRNMGFDYYLNAVDEINLKIKEEFEKEGIEMAFPTYTVYLEKDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MJ0170 |
Synonyms | MJ0170; Small-conductance mechanosensitive channel MscMJ |
UniProt ID | Q57634 |
◆ Recombinant Proteins | ||
BTD-8393H | Recombinant Human BTD, MYC/DDK-tagged | +Inquiry |
FLOT2-2362R | Recombinant Rat FLOT2 Protein | +Inquiry |
PGAM1-1656H | Recombinant Human PGAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FZD2-8756Z | Recombinant Zebrafish FZD2 | +Inquiry |
DPH3P1-5124H | Recombinant Human DPH3P1, His-tagged | +Inquiry |
◆ Native Proteins | ||
LPA-8453H | Native Human LPA | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF207-122HCL | Recombinant Human ZNF207 293 Cell Lysate | +Inquiry |
SMYD3-2506HCL | Recombinant Human SMYD3 cell lysate | +Inquiry |
SW620-019WCY | Human Colon Adenocarcinoma SW620 Whole Cell Lysate | +Inquiry |
CBLN1-7812HCL | Recombinant Human CBLN1 293 Cell Lysate | +Inquiry |
KLRK1-001HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MJ0170 Products
Required fields are marked with *
My Review for All MJ0170 Products
Required fields are marked with *
0
Inquiry Basket