Recombinant Full Length Measles Virus Hemagglutinin Glycoprotein(H) Protein, His-Tagged
Cat.No. : | RFL15480MF |
Product Overview : | Recombinant Full Length Measles virus Hemagglutinin glycoprotein(H) Protein (P08362) (1-617aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Measles Virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-617) |
Form : | Lyophilized powder |
AA Sequence : | MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRL HRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISD KIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLETRTTNQF LAVSKGNCSGPTTIRGQFSNMSLSLLDLYLGRGYNVSSIVTMTSQGMYGGTYLVEKPNLS SKRSELSQLSMYRVFEVGVIRNPGLGAPVFHMTNYLEQPVSNDLSNCMVALGELKLAALC HGEDSITIPYQGSGKGVSFQLVKLGVWKSPTDMQSWVPLSTDDPVIDRLYLSSHRGVIAD NQAKWAVPTTRTDDKLRMETCFQQACKGKIQALCENPEWAPLKDNRIPSYGVLSVDLSLT VELKIKIASGFGPLITHGSGMDLYKSNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSP YLFNVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVY YVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDQKLWCRHFCVLADSESGGHITHSGME GMGVSCTVTREDGTNRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | H |
Synonyms | H; Hemagglutinin glycoprotein |
UniProt ID | P08362 |
◆ Recombinant Proteins | ||
NDUFS1-1841Z | Recombinant Zebrafish NDUFS1 | +Inquiry |
CABS1-5199H | Recombinant Human CABS1 Protein, GST-tagged | +Inquiry |
POXB-1305E | Recombinant Escherichia coli POXB Protein (1-572 aa), His-tagged | +Inquiry |
ISPD-2732S | Recombinant Staphylococcus epidermidis ATCC 12228 ISPD protein, His-tagged | +Inquiry |
NFYA-1470C | Recombinant Chicken NFYA | +Inquiry |
◆ Native Proteins | ||
Tf-264R | Native Rat Transferrin | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
TF-391H | Native Human Transferrin | +Inquiry |
FDP-E-50H | Native Human Fibrinogen Degrading Product-E | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHKA2-1346HCL | Recombinant Human PHKA2 cell lysate | +Inquiry |
SUV39H1-1334HCL | Recombinant Human SUV39H1 293 Cell Lysate | +Inquiry |
BPIFA2-1338HCL | Recombinant Human BPIFA2 cell lysate | +Inquiry |
EPN3-6579HCL | Recombinant Human EPN3 293 Cell Lysate | +Inquiry |
LDLRAP1-4784HCL | Recombinant Human LDLRAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H Products
Required fields are marked with *
My Review for All H Products
Required fields are marked with *
0
Inquiry Basket