Recombinant Full Length Measles Virus Hemagglutinin Glycoprotein(H) Protein, His-Tagged
Cat.No. : | RFL4352MF |
Product Overview : | Recombinant Full Length Measles virus Hemagglutinin glycoprotein(H) Protein (Q786F2) (1-617aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Measles Virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-617) |
Form : | Lyophilized powder |
AA Sequence : | MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRL HRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISD KIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQF LAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLS SKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALC HREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIAD NQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLT VELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSP NLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVY YVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMV GMGVSCTVTREDGTNRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | H |
Synonyms | H; Hemagglutinin glycoprotein |
UniProt ID | Q786F2 |
◆ Recombinant Proteins | ||
MUP11-5809M | Recombinant Mouse MUP11 Protein, His (Fc)-Avi-tagged | +Inquiry |
POLR2A-1149H | Active Recombinant Human POLR2A, CT Domain | +Inquiry |
RFL5897HF | Recombinant Full Length Uncharacterized Protein Rv1417/Mt1460 (Rv1417, Mt1460) Protein, His-Tagged | +Inquiry |
SSU72-1785C | Recombinant Chicken SSU72 | +Inquiry |
RNF215-14334M | Recombinant Mouse RNF215 Protein | +Inquiry |
◆ Native Proteins | ||
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
C4-12H | Active Native Human C4 protein | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHISA4-1856HCL | Recombinant Human SHISA4 293 Cell Lysate | +Inquiry |
UBR3-2068HCL | Recombinant Human UBR3 cell lysate | +Inquiry |
EHMT2-6684HCL | Recombinant Human EHMT2 293 Cell Lysate | +Inquiry |
METTL25-8326HCL | Recombinant Human C12orf26 293 Cell Lysate | +Inquiry |
TMEM8B-260HCL | Recombinant Human TMEM8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H Products
Required fields are marked with *
My Review for All H Products
Required fields are marked with *
0
Inquiry Basket