Recombinant Full Length Mannheimia Succiniciproducens Magnesium Transport Protein Cora(Cora) Protein, His-Tagged
Cat.No. : | RFL35844MF |
Product Overview : | Recombinant Full Length Mannheimia succiniciproducens Magnesium transport protein CorA(corA) Protein (Q65VT3) (1-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mannheimia succiniciproducens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-316) |
Form : | Lyophilized powder |
AA Sequence : | MINAFALENARLTRLDEDNLSTLNKAIWIDLVEPTSEEREILQDGLEQSLASFLELEDIE ASARFFEDEDGLHLHSFFYCEDEEDYADLASVAFTIRDGRLFTLRDRDLPAFRLYRMRSR YQRLDECNAYEVLLDLFETKIEQLADVIETVYSDLERLSRVILDGKQGEAFDDALGTLTE QEDMSSKVRLCLMDTQRALSFLVRKTRLPANQLEQAREILRDIESLQPHNESLFQKVNFL MQAAMGYINIEQNRVMKFFSVVSVMFLPATLVASTYGMNFEFMPELGFKYGYPMAIGLMI AAGVTPYMYFKRKGWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | corA |
Synonyms | corA; MS0320; Magnesium transport protein CorA |
UniProt ID | Q65VT3 |
◆ Recombinant Proteins | ||
PRSS3-4742R | Recombinant Rat PRSS3 Protein | +Inquiry |
Zfp207-7080M | Recombinant Mouse Zfp207 Protein, Myc/DDK-tagged | +Inquiry |
S-67S | Recombinant 2019-nCoV Spike Protein RBD (L452Q, F490S), His-tagged | +Inquiry |
UNC45A-17844M | Recombinant Mouse UNC45A Protein | +Inquiry |
FGF17-12866H | Recombinant Human FGF17, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-559M | MiniPig Colon Lysate, Total Protein | +Inquiry |
RAPGEF1-2522HCL | Recombinant Human RAPGEF1 293 Cell Lysate | +Inquiry |
CAB39L-7911HCL | Recombinant Human CAB39L 293 Cell Lysate | +Inquiry |
CD6-1807MCL | Recombinant Mouse CD6 cell lysate | +Inquiry |
MSH5-4118HCL | Recombinant Human MSH5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All corA Products
Required fields are marked with *
My Review for All corA Products
Required fields are marked with *
0
Inquiry Basket