Recombinant Full Length Paracoccus Denitrificans Macrolide Export Atp-Binding/Permease Protein Macb 1/2(Macb1) Protein, His-Tagged
Cat.No. : | RFL5209PF |
Product Overview : | Recombinant Full Length Paracoccus denitrificans Macrolide export ATP-binding/permease protein MacB 1/2(macB1) Protein (A1B677) (1-668aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccus Denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-668) |
Form : | Lyophilized powder |
AA Sequence : | MAETGAPLIRLRGVGREYPSGEGVLRVLTDIDLDIGQGEFVAVMGASGSGKSTLMNILGC LDRPSSGSYRMDGREVARLGAGELAALRRETFGFIFQRYHLLSEMTALGNVEVPAIYRGL PADARRARARDLLERLGLGDRTGHRPGQLSGGQQQRVSIARALVNDARVILADEPTGALD SRSGDEVLGILERLNAEGRTVVIVTHDPRVAARAHRVVEIADGRIVADRRTGAPAADPGP GPAQAPQPAPQPAPVQAPVQARVQARAAVPVLGRLAEALRMALLSMRAHKLRSFLTMLGI IIGIASVVSVVALGEGSRRQVLQNIAGLGTNTLQIFPGRDFGDMRSGRVTTLVTADAAAL ARQPHVASVSPTVGTSATLRHGATEASAQISGVGEQYFDVAGVALTQGRGFDEADVAAMG QNVVIDENTRTSLFGDGPALGQVFMAGKVPLRVIGVAEAQNRGPGGSTSLTVYAPYTTVQ ARYLGSTSVSGLTLRVADDVDMALAEQMVADILTRRHGTRDFFIVNNDQIRQTITSTTQT LALLIAAIAVISLVVGGIGVMNIMLVSVTERIGEIGLRMAVGARRGDIRAQFLIEAVLVC VIGGIAGILAALGFGLAFERMSSDFTLVYSPLSMLAALASACAIGLAFGYLPAVNAAKLD PVKALQKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB1 |
Synonyms | macB1; Pden_2937; macB2; Pden_3444; Macrolide export ATP-binding/permease protein MacB 1/2 |
UniProt ID | A1B677 |
◆ Recombinant Proteins | ||
PDE12-3162R | Recombinant Rhesus Macaque PDE12 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACACB-1156M | Recombinant Mouse ACACB Protein | +Inquiry |
PLBD1-7143Z | Recombinant Zebrafish PLBD1 | +Inquiry |
PJA1-6775M | Recombinant Mouse PJA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21594EF | Recombinant Full Length Escherichia Coli O8 Protein Psie(Psie) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
PROC-64H | Active Native Human Activated Protein C | +Inquiry |
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
KRT18-173B | Native bovine KRT18 | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
VPS28-392HCL | Recombinant Human VPS28 293 Cell Lysate | +Inquiry |
Ileum-244H | Human Ileum Liver Cirrhosis Lysate | +Inquiry |
TMEM186-979HCL | Recombinant Human TMEM186 293 Cell Lysate | +Inquiry |
C18orf32-8220HCL | Recombinant Human C18orf32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB1 Products
Required fields are marked with *
My Review for All macB1 Products
Required fields are marked with *
0
Inquiry Basket