Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb 1(Macb1) Protein, His-Tagged
Cat.No. : | RFL3848YF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB 1(macB1) Protein (Q66CL2) (1-649aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pseudotuberculosis Serotype I |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-649) |
Form : | Lyophilized powder |
AA Sequence : | MAALLELEGIRRSYQSGEEIVDVLQDVSLTINAGELVAIIGASGSGKSTLMNILGCLDKP SAGIYRVAGQNVDELDDDALAALRREHFGFIFQRYHLLPHLSAAHNVEVPAVYAGLGKHE RRERANMLLTRLGLGDRVSYQPNQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSS VEVMAILKQLQQQGHTVIIVTHDPTVAAQAERVIEIKDGRIMADSGSKNEPVVAAAELMS LTPAAPSWQQLVGRFREALLMAWRAMSANKMRTALTMLGIIIGIASVVSILVVGDAAKQL VLADIRAIGTNTIDIYPGKDFGDDDPSTRQALVHDDMAALKAQSYVSAVSPSIGGSMRLR FGNIDVAASVLGVSDEYFRVFGMAMEQGAPITREQVERQAQTVVIDLNTQRRLFPHMKDV VGQVILVGNMPATVVGVVAEKKSMFGSNKALRVWVPYSTMANRLMGRSYFDSITIRIKEG YSSKEAEQQLVRLLTLRHGKKDIFTYNMDSLLQTAEKTTQTMQLFLTLVAVISLVVGGIG VMNIMLVSVTERTREIGIRMAVGARSSDVMQQFLIEAVLVCLIGGALGISLSFAIGLIVE MFLPNWRIAFPPMALFSAFLCSTVIGVVFGYLPARSAARLNPIDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB1 |
Synonyms | macB1; YPTB1391; Macrolide export ATP-binding/permease protein MacB 1 |
UniProt ID | Q66CL2 |
◆ Recombinant Proteins | ||
DNAH9-10763Z | Recombinant Zebrafish DNAH9 | +Inquiry |
GK2-546C | Recombinant Cynomolgus GK2 Protein, His-tagged | +Inquiry |
CACYBP-606R | Recombinant Rhesus monkey CACYBP Protein, His-tagged | +Inquiry |
RFL17518PF | Recombinant Full Length Pinctada Fucata Prisilkin-39 Protein, His-Tagged | +Inquiry |
EGFL6-3114H | Recombinant Human EGFL6 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CA6-804H | Native Human CA6 | +Inquiry |
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJB5-707HCL | Recombinant Human GJB5 cell lysate | +Inquiry |
GRIA3-752HCL | Recombinant Human GRIA3 cell lysate | +Inquiry |
ELL-6626HCL | Recombinant Human ELL 293 Cell Lysate | +Inquiry |
AOC2-8823HCL | Recombinant Human AOC2 293 Cell Lysate | +Inquiry |
CABYR-7906HCL | Recombinant Human CABYR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB1 Products
Required fields are marked with *
My Review for All macB1 Products
Required fields are marked with *
0
Inquiry Basket