Recombinant Full Length Macrococcus Caseolyticus Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL11849MF |
Product Overview : | Recombinant Full Length Macrococcus caseolyticus Undecaprenyl-diphosphatase(uppP) Protein (B9EA92) (1-281aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macrococcus caseolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-281) |
Form : | Lyophilized powder |
AA Sequence : | MTFFELVKALILGIVEGLTEFAPVSSTGHQILVDDMWLQTKYVLNSQESANTFKIVIQLG SIFAAAWIFRHRFLEVLHIEKTKTEGPRLNLLHIFIGLIPAGIMGLLFDDFIDKHLFSVP TVLIGLALGALLMIAADLFNKKVTHTTTVDEMTYKQALIIGVAQCLALWPGFSRSGSTIS AGVLLKMNHKAASDFTFIMAVPIMFAASAKSLASNIQYIHSDQILFYIVGFIAAFIFGVL SIRLFLSLINRVKLMPFAIYRLILVAVIAVLYFGFGIGKGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; MCCL_0446; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | B9EA92 |
◆ Native Proteins | ||
GC-198H | Native Human GC-Globulin | +Inquiry |
Gliadin-168W | Native Wheat Gliadin | +Inquiry |
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
SW-13-1727H | SW-13 (human small cell carcinoma of the adrenal cortex) nuclear extract lysate | +Inquiry |
ASTL-43HCL | Recombinant Human ASTL lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
MANF-2212HCL | Recombinant Human MANF cell lysate | +Inquiry |
ST6GAL1-1760MCL | Recombinant Mouse ST6GAL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket