Recombinant Full Length Synechococcus Sp. Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL3579SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Undecaprenyl-diphosphatase(uppP) Protein (Q7U482) (1-287aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-287) |
Form : | Lyophilized powder |
AA Sequence : | MADPSASLGLWEACWRDLVLGIVQGLTEFLPISSTAHLKVVPVLLDWGDPGVSVTAAIQL GSIVAVIAYFRRDLAQVMQGISKAFRHGQWREPEARLGIAMAVGTLPILAVGLAIKLFWD EGYETSPLRSVPSIAVVSIVMALLLAVAERMGPRRKQLSDVSGRDGLVVGLAQVLALIPG VSRSGSTLTASLLDGWQRADAARFSFLLGIPAITIAGIVELKDALAATADAGPLPLVIGI LAATVVSWLAIDWLLKFLQRHSTWLFVAYRLLFGVGLLAWWSIHGAH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; bacA; upk; SYNW2189; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q7U482 |
◆ Recombinant Proteins | ||
LY86-5343H | Recombinant Human LY86 Protein (Gly21-Ser162), C-Fc tagged | +Inquiry |
RFL9513HF | Recombinant Full Length Human Olfactory Receptor 10G2(Or10G2) Protein, His-Tagged | +Inquiry |
CLEC3A-4997C | Recombinant Chicken CLEC3A | +Inquiry |
ANAPC10-5701H | Recombinant Human ANAPC10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MADD-2409H | Recombinant Human MADD Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-263R | Rhesus monkey Kidney Lysate | +Inquiry |
RBM4-531HCL | Recombinant Human RBM4 lysate | +Inquiry |
Thyroid-581M | MiniPig Thyroid Lysate, Total Protein | +Inquiry |
FAM122B-6442HCL | Recombinant Human FAM122B 293 Cell Lysate | +Inquiry |
WDR6-736HCL | Recombinant Human WDR6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket